Skip to content
  • support@behemothLabz.com
  • Accordion Panel

    Notifications

    Products On Sale

    Don't miss out on these discounted products!
    Act fast before the sale ends!

    Notification Arrow Menu Icon | Behemothlabz

    Semax Nasal Spray

    Notification Arrow Menu Icon | Behemothlabz

    SR-9011 Capsules

    Notification Arrow Menu Icon | Behemothlabz

    GHRP-6 Nasal Spray

    Notification Arrow Menu Icon | Behemothlabz

    YK-11 (Myostine) Capsules

    Notification Arrow Menu Icon | Behemothlabz

    1.4 DMAA Liquid

    Notification Arrow Menu Icon | Behemothlabz

    MOTS-C Nasal Spray

    Notification Arrow Menu Icon | Behemothlabz

    4-Andro Liquid

    Notification Arrow Menu Icon | Behemothlabz

    Adipotide Nasal Spray

    Out of Stock

    The following products are currently out of stock

    Notification Arrow Menu Icon | Behemothlabz

    Follistatin 315 98%

    Notification Arrow Menu Icon | Behemothlabz

    Follistatin 344 85%

  • Cart

    No products in the cart.

    Return to shop

  • support@behemothLabz.com
BEHEMOTH LABZBEHEMOTH LABZ
        • Merchandise
              • Top Merchandise
                • LED Flashlight
                • Sleeveless Hoodie
                • Hoodie
                • Lighter Refill Gas (Butane Fuel)
              • Gym Merchandise
                • Behemothlabz Gym Tank Tops
                • 20oz Plastic Shaker Bottle
                • Gym Duffle Bag (18″x11″x10″)
                • Lifting Straps
                • 25oz Stainless Steel Shaker
              • IMG 1 247x296 1 | Behemoth
              • Gym Tank Tops

                Rated 5.00 out of 5
                $32.48
                Select options
              • View All Products
        • About Us
              • How We Work
              • This section outlines the evolution and milestones of Behemothlabz from its founding in 2014 to its continued growth and innovation in 2024.

              • Contact
              • This section provides all our contact details, encouraging you to reach out for assistance or inquiries. It encompasses live chat, phone support, and email options, ensuring accessibility for all.

              • Become an Affiliate
              • Discover all you need to know to partner with us and promote our products to earn rewards.

              • FAQ's
              • In our FAQs section, we have compiled answers to the questions we frequently receive. Quickly find information about our company, products, and policies. If you have any questions, you might find the answer here before reaching out to us directly.

              • Quality Control and Testing
              • In our Quality Control and Testing section, we uphold Behemothlabz's Commitment to Quality by meticulously detailing our procedures.

              • Download BehemothLabz eBook
              • Browse our selection of research-focused eBooks covering SARMs, Peptides, Nootropics, Supplements, Kratom, and everything related to our compounds. Gain in-depth knowledge backed by science and expert analysis.

        • Articles
              • Sermorelin Vs Hexarelin | Behemothlabz
                Hexarelin vs Sermorelin: Mechanism, Similarities, Differences, and Side Effects

                Hexarelin and sermorelin are the two new synthetic peptides. They consist of small chains of [...]

                PE-22-28 Peptide
                PE-22-28 Peptide: Benefits, Side Effects, and More

                Few compounds can potentially influence cell regulation and improve cognitive development in research subjects. PE-22-28 [...]

                RAD 150 vs RAD 140
                RAD 150 vs RAD 140 Explained: Potency, Effects, and the Best Option

                RAD-140, also known as Testolone, and RAD-150 belong to SARMS. They both have shown promising [...]

                Read More Articles
    • Home
    • Browse All
    • SARMs
    • Peptides
    • Blog
    • Contact
  • Our Story
  • Accordion Panel

    Notifications

    Products On Sale

    Don't miss out on these discounted products!
    Act fast before the sale ends!

    Notification Arrow Menu Icon | Behemothlabz

    Semax Nasal Spray

    Notification Arrow Menu Icon | Behemothlabz

    SR-9011 Capsules

    Notification Arrow Menu Icon | Behemothlabz

    GHRP-6 Nasal Spray

    Notification Arrow Menu Icon | Behemothlabz

    YK-11 (Myostine) Capsules

    Notification Arrow Menu Icon | Behemothlabz

    1.4 DMAA Liquid

    Notification Arrow Menu Icon | Behemothlabz

    MOTS-C Nasal Spray

    Notification Arrow Menu Icon | Behemothlabz

    4-Andro Liquid

    Notification Arrow Menu Icon | Behemothlabz

    Adipotide Nasal Spray

    Out of Stock

    The following products are currently out of stock

    Notification Arrow Menu Icon | Behemothlabz

    Follistatin 315 98%

    Notification Arrow Menu Icon | Behemothlabz

    Follistatin 344 85%

PNC-27
Injectables

PNC-27

[ah_youtube_iframe]
Coming soon
Filter By
  • Ancillaries (3)
  • Best Research SARMs (23)
  • Capsules (60)
  • Discounted (0)
  • eBook (0)
  • Free Gifts (0)
  • Gift (1)
  • Gummies (3)
  • HGH (1)
  • Injectables (10)
  • Liquids (10)
  • Merchandise (0)
  • Miscellaneous (1)
  • Nootropics (26)
  • PCT (10)
  • Peptide (13)
  • Peptides (116)
  • Phenibut (1)
  • Prohormones (10)
  • Prohormones Capsules (7)
  • Prohormones Liquid (0)
  • SARM Capsules (19)
  • SARM Injectables (1)
  • SARM Liquids (6)
  • SARM Support (4)
  • SARM Support Capsules (6)
  • SARM Support Liquid (2)
  • Sarms Stacks (22)
  • Sprays (6)
  • Supplementary Capsules (26)
  • Supplementary Powders (28)
  • Supplements (40)
  • Transdermals (2)
  • Uncategorized (3)
Description

Product Details: PNC-27 (10mg)

PNC-27 is a lab-made peptide. It is a synthetic p53-derived peptide containing an HDM-2 binding domain. It is being studied in experimental and preclinical models for its interaction with membrane-associated HDM-2 proteins expressed in abnormal cell lines. 

These interactions play a significant role in regulating various cellular pathways, including necrotic membrane disruption and cell membrane integrity in laboratory settings.

Originally investigated for its role in tumor suppressor-related pathways, PNC-27 has gained research interest due to its selective activity on HDM-2-expressing cell membranes. 

Its defined peptide structure and receptor selectivity make it an excellent compound for studying peptide-membrane interactions and necrotic membrane disruption mechanisms in controlled experimental environments.

Mechanism of Action

In preclinical and experimental settings, PNC-27 is characterized as an HDM-2-targeting peptide. It demonstrates notable affinity for membrane-bound HDM-2 proteins overexpressed in abnormal cell models within in vitro systems. Activation of this interaction is studied for its effects on membrane destabilization and downstream necrosis.

Through targeted binding, PNC-27 is used in laboratory research to investigate HDM-2-mediated membrane disruption, apoptotic pathway activation, and peptide-driven cell regulatory mechanisms. Its selectivity for HDM-2-expressing membranes allows researchers to examine receptor-specific responses and downstream biochemical processes in controlled systems.

Importantly, published preclinical studies consistently characterize PNC-27-induced cell death as necrosis, not apoptosis. Necrosis was confirmed via LDH release assays and the absence of apoptotic markers in HDM-2-expressing cancer cell lines. This mechanistic distinction is documented in all primary published references for this compound." [Sarafraz-Yazdi et al., 2010; Fenelus et al., 2020] 

Properties of PNC-27 (10mg)

  • Molecular Formula: C₁₈₈H₂₉₃N₅₃O₄₄S 
  • Molecular Weight: ~4,031.7 g/mol 
  • CAS Number: CAS Number: Not independently confirmed in major chemical registries; compound identified by sequence PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG and confirmed MW ~4,031.7 g/mol 
  • Peptide Sequence: PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG 
  • Peptide Class: Synthetic p53-derived apoptotic peptide
  • Synonyms: PNC-27; PNC27; p53 peptide analog; HDM-2 binding peptide
  • Purity: ≥99% (as confirmed by third-party analytical testing)
  • Form: Lyophilized powder

Research Applications/Benefits of PNC-27 (10mg)

HDM-2 Membrane Interaction Research

PNC-27 is used in laboratory studies to investigate HDM-2 membrane-associated protein binding, activation, and downstream necrotic membrane disruption in controlled experimental models.

Apoptotic Pathway Studies

Applied in preclinical systems to examine peptide-induced membrane destabilization and programmed cell death pathways within abnormal cell line models and related biochemical responses.

Tumor Suppressor Signaling Analysis 

Utilized in experimental models to explore p53-derived peptide involvement in tumor suppressor-related signaling and HDM-2-mediated regulatory mechanisms.

Peptide-Membrane Interaction Studies 

Serves as a model compound for analyzing ligand-membrane specificity, binding affinity, and downstream intracellular necrotic membrane disruption in laboratory environments.

Selective Cell Line Targeting Investigation 

Used in controlled research settings to study HDM-2 overexpression-dependent membrane disruption and its role in selective necrotic membrane disruption cascades.

Why Choose BehemothLabz to Buy PNC-27 (10mg)

BehemothLabz is committed to providing high-purity research peptides manufactured under strict quality control standards. Each batch of PNC-27 undergoes independent third-party analytical testing to confirm identity, purity, and consistency. With a focus on transparency and scientific reliability, BehemothLabz supports researchers with dependable compounds suitable for advanced laboratory and preclinical investigations.

Support is direct: support@behemothLabz.com | (307) 429-0990.

Disclaimer: This compound is not approved by the U.S. Food and Drug Administration (FDA) for human or veterinary use. It is provided strictly for laboratory and scientific research purposes only. Clinical research initiatives must be conducted under IRB guidance; preclinical animal studies must comply with IACUC directives under the Animal Welfare Act (AWA). Not for human consumption, injection, or any form of administration. 

Please make sure you go through the Terms and Conditions. Please research the scientific uses of this product before making any purchases. Make note that the packaging and labels of the product may differ from those shown on the website.

Reference Links

Fenelus, M., Poon, C. K., Sarkar, A., Trivigno, V., Zolkind, P. A., Matthew, S. M., Grin'kina, N., Orynbayeva, Z., Shaikh, M. F., Adler, V., Michl, J., Sarafraz-Yazdi, E., Pincus, M. R., & Bowne, W. B. (2020). Targeting membrane HDM-2 by PNC-27 induces necrosis in leukemia cells but not in normal hematopoietic cells. PubMed. https://pubmed.ncbi.nlm.nih.gov/32878773/

Sarafraz-Yazdi, E., Mumin, S., Cheung, D., Fridman, D., Lin, B., Wong, L., Rosal, R., Rudolph, R., 

Frenkel, M., Thadi, A., Morano, W. F., Bowne, W. B., Pincus, M. R., & Michl, J. (2022). PNC-27, a chimeric p53-penetratin peptide, binds to HDM-2 in a p53 peptide-like structure, induces selective membrane-pore formation, and leads to cancer cell lysis. Biomedicines, 10(5), 945. https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9138867/

Sarafraz-Yazdi, E., Bowne, W. B., Adler, V., Bhargava, A., Zeitlin, B. D., Banerjee, S., Brandwein, A., Bhatt, D., Du, M., Vu, H. H., Michl, J., & Pincus, M. R. (2010). Anticancer peptide PNC-27 adopts an HDM-2-binding conformation and kills cancer cells by binding to HDM-2 in their membranes. PubMed. https://pubmed.ncbi.nlm.nih.gov/20080680/

Bowne, W. B., Michl, J., Bluth, M. H., Zenilman, M. E., Pincus, M. R., & Sarafraz-Yazdi, E. (2008). The penetration sequence in the anticancer PNC-28 peptide causes tumor cell necrosis rather than apoptosis of human pancreatic cancer cells. PubMed. https://pubmed.ncbi.nlm.nih.gov/18931881/

How to Pay

Please click here to access instructions on how to make a payment.

How to Pay

Related products

L-Carnitine
Out of stock

L-Carnitine Injectable

Read More
N-Acetyl PT-141

N-Acetyl PT-141

Read More
Larazotide Acetate (AT-1001, 10mg)

Larazotide Acetate (AT-1001, 10mg)

Read More
Astressin B 10mg

Astressin B 10mg

Read More
Behemothlabz | Footer Logo

All products referenced on this website are intended for research and identification purposes only. BehemothLabz does not sell, manufacture, or ship any product directly — availability, dosing warnings, and handling are the responsibility of the third-party supplier. Nothing here is intended for human dosing, injection, or ingestion.

oUR COMPANY

About Us
Contact Us

oUR PoLICIES

Privacy Policy
Terms and Conditions

EXPLORE

Blog
Products

CATEGORIES

Peptides
Nootropics

© 2026 BehemothLabz.com, All Rights Reserved.

support@behemothlabz.com | © BehemothLabz

  • Home
  • Browse All
  • SARMs
  • Peptides
  • Blog
  • Contact
  • Login
        • Merchandise
              • Top Merchandise
                • LED Flashlight
                • Sleeveless Hoodie
                • Hoodie
                • Lighter Refill Gas (Butane Fuel)
              • Gym Merchandise
                • Behemothlabz Gym Tank Tops
                • 20oz Plastic Shaker Bottle
                • Gym Duffle Bag (18″x11″x10″)
                • Lifting Straps
                • 25oz Stainless Steel Shaker
              • IMG 1 247x296 1 | Behemoth
              • Gym Tank Tops

                Rated 5.00 out of 5
                $32.48
                Select options
              • View All Products
        • About Us
              • How We Work
              • This section outlines the evolution and milestones of Behemothlabz from its founding in 2014 to its continued growth and innovation in 2024.

              • Contact
              • This section provides all our contact details, encouraging you to reach out for assistance or inquiries. It encompasses live chat, phone support, and email options, ensuring accessibility for all.

              • Become an Affiliate
              • Discover all you need to know to partner with us and promote our products to earn rewards.

              • FAQ's
              • In our FAQs section, we have compiled answers to the questions we frequently receive. Quickly find information about our company, products, and policies. If you have any questions, you might find the answer here before reaching out to us directly.

              • Quality Control and Testing
              • In our Quality Control and Testing section, we uphold Behemothlabz's Commitment to Quality by meticulously detailing our procedures.

              • Download BehemothLabz eBook
              • Browse our selection of research-focused eBooks covering SARMs, Peptides, Nootropics, Supplements, Kratom, and everything related to our compounds. Gain in-depth knowledge backed by science and expert analysis.

        • Articles
              • Sermorelin Vs Hexarelin | Behemothlabz
                Hexarelin vs Sermorelin: Mechanism, Similarities, Differences, and Side Effects

                Hexarelin and sermorelin are the two new synthetic peptides. They consist of small chains of [...]

                PE-22-28 Peptide
                PE-22-28 Peptide: Benefits, Side Effects, and More

                Few compounds can potentially influence cell regulation and improve cognitive development in research subjects. PE-22-28 [...]

                RAD 150 vs RAD 140
                RAD 150 vs RAD 140 Explained: Potency, Effects, and the Best Option

                RAD-140, also known as Testolone, and RAD-150 belong to SARMS. They both have shown promising [...]

                Read More Articles
  • Our Story

Login

Lost your password?

Register

Your personal data will be used to support your experience throughout this website, to manage access to your account, and for other purposes described in our privacy policy.