PNC-27

Product Details: PNC-27 (10mg)

PNC-27 is a lab-made peptide. It is a synthetic p53-derived peptide containing an HDM-2 binding domain. It is being studied in experimental and preclinical models for its interaction with membrane-associated HDM-2 proteins expressed in abnormal cell lines. 

These interactions play a significant role in regulating various cellular pathways, including necrotic membrane disruption and cell membrane integrity in laboratory settings.

Originally investigated for its role in tumor suppressor-related pathways, PNC-27 has gained research interest due to its selective activity on HDM-2-expressing cell membranes. 

Its defined peptide structure and receptor selectivity make it an excellent compound for studying peptide-membrane interactions and necrotic membrane disruption mechanisms in controlled experimental environments.

Mechanism of Action

In preclinical and experimental settings, PNC-27 is characterized as an HDM-2-targeting peptide. It demonstrates notable affinity for membrane-bound HDM-2 proteins overexpressed in abnormal cell models within in vitro systems. Activation of this interaction is studied for its effects on membrane destabilization and downstream necrosis.

Through targeted binding, PNC-27 is used in laboratory research to investigate HDM-2-mediated membrane disruption, apoptotic pathway activation, and peptide-driven cell regulatory mechanisms. Its selectivity for HDM-2-expressing membranes allows researchers to examine receptor-specific responses and downstream biochemical processes in controlled systems.

Importantly, published preclinical studies consistently characterize PNC-27-induced cell death as necrosis, not apoptosis. Necrosis was confirmed via LDH release assays and the absence of apoptotic markers in HDM-2-expressing cancer cell lines. This mechanistic distinction is documented in all primary published references for this compound." [Sarafraz-Yazdi et al., 2010; Fenelus et al., 2020] 

Properties of PNC-27 (10mg)

• Molecular Formula: C₁₈₈H₂₉₃N₅₃O₄₄S 
• Molecular Weight: ~4,031.7 g/mol 
• CAS Number: CAS Number: Not independently confirmed in major chemical registries; compound identified by sequence PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG and confirmed MW ~4,031.7 g/mol 
• Peptide Sequence: PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG 
• Peptide Class: Synthetic p53-derived apoptotic peptide
• Synonyms: PNC-27; PNC27; p53 peptide analog; HDM-2 binding peptide
• Purity: ≥99% (as confirmed by third-party analytical testing)
• Form: Lyophilized powder

Research Applications/Benefits of PNC-27 (10mg)

HDM-2 Membrane Interaction Research

PNC-27 is used in laboratory studies to investigate HDM-2 membrane-associated protein binding, activation, and downstream necrotic membrane disruption in controlled experimental models.

Apoptotic Pathway Studies

Applied in preclinical systems to examine peptide-induced membrane destabilization and programmed cell death pathways within abnormal cell line models and related biochemical responses.

Tumor Suppressor Signaling Analysis 

Utilized in experimental models to explore p53-derived peptide involvement in tumor suppressor-related signaling and HDM-2-mediated regulatory mechanisms.

Peptide-Membrane Interaction Studies 

Serves as a model compound for analyzing ligand-membrane specificity, binding affinity, and downstream intracellular necrotic membrane disruption in laboratory environments.

Selective Cell Line Targeting Investigation 

Used in controlled research settings to study HDM-2 overexpression-dependent membrane disruption and its role in selective necrotic membrane disruption cascades.

Reference Links

• Fenelus, M., Poon, C. K., Sarkar, A., Trivigno, V., Zolkind, P. A., Matthew, S. M., Grin'kina, N., Orynbayeva, Z., Shaikh, M. F., Adler, V., Michl, J., Sarafraz-Yazdi, E., Pincus, M. R., & Bowne, W. B. (2020). Targeting membrane HDM-2 by PNC-27 induces necrosis in leukemia cells but not in normal hematopoietic cells. PubMed. https://pubmed.ncbi.nlm.nih.gov/32878773/
• Sarafraz-Yazdi, E., Mumin, S., Cheung, D., Fridman, D., Lin, B., Wong, L., Rosal, R., Rudolph, R., 
• Frenkel, M., Thadi, A., Morano, W. F., Bowne, W. B., Pincus, M. R., & Michl, J. (2022). PNC-27, a chimeric p53-penetratin peptide, binds to HDM-2 in a p53 peptide-like structure, induces selective membrane-pore formation, and leads to cancer cell lysis. Biomedicines, 10(5), 945. https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9138867/
• Sarafraz-Yazdi, E., Bowne, W. B., Adler, V., Bhargava, A., Zeitlin, B. D., Banerjee, S., Brandwein, A., Bhatt, D., Du, M., Vu, H. H., Michl, J., & Pincus, M. R. (2010). Anticancer peptide PNC-27 adopts an HDM-2-binding conformation and kills cancer cells by binding to HDM-2 in their membranes. PubMed. https://pubmed.ncbi.nlm.nih.gov/20080680/
• Bowne, W. B., Michl, J., Bluth, M. H., Zenilman, M. E., Pincus, M. R., & Sarafraz-Yazdi, E. (2008). The penetration sequence in the anticancer PNC-28 peptide causes tumor cell necrosis rather than apoptosis of human pancreatic cancer cells. PubMed. https://pubmed.ncbi.nlm.nih.gov/18931881/

Please click here to see how purchases actually work on this site.